PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008238940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TALE
Protein Properties Length: 716aa    MW: 80363.8 Da    PI: 6.7813
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008238940.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.2e-094695061954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_008238940.1 469 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 506
                     554459******************************88 PP

2BELL113.89.1e-37331401272
            BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     + elqk+k++Lls+leeV++rYk+y++q+++v+ssFe+vag g+a++Y +lA ka+SrhFr+Lkd i++qi
  XP_008238940.1 331 FVELQKRKTRLLSMLEEVERRYKHYCDQMKAVVSSFETVAGAGAATVYSALAAKAMSRHFRSLKDGIVSQI 401
                     679*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.0E-55261399IPR006563POX domain
PfamPF075262.4E-46267397IPR006563POX domain
PROSITE profilePS5007112.179447510IPR001356Homeobox domain
CDDcd000863.17E-11450511No hitNo description
SMARTSM003895.8E-9450514IPR001356Homeobox domain
SuperFamilySSF466896.84E-17451516IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-27453516IPR009057Homeodomain-like
PfamPF059209.8E-18467506IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MAGQLSEAKP RNMVSSSVGF CYSDVSSNPT IHQTQFTNQI QDFGSNPEIF NLTTGMEMIG  60
FLKQNESNNN SAMWKAGFFG KPGNHQAGPS SSKTINESTS SDFYHHQHEF NNKQPDFSTG  120
ISETSSDHHQ NLMVGPQHQD SSGAWQENRF LVDDSSLRCV FPCEGNERPS QGLSLSLSSN  180
NPSSIGLQSF ELRQTNQHQP HQQDQQDDDD EENVDHMRFI SSASRDSVGL FGKPSANMQQ  240
QMNMMQDGFL GKATASSSLH PEGLFHLRNS KYLAPAQQLL NEFCSLGTKP STDHLHPSMQ  300
KPHKNKLWEQ EDNGTTSSSR NKQSNIYSLE FVELQKRKTR LLSMLEEVER RYKHYCDQMK  360
AVVSSFETVA GAGAATVYSA LAAKAMSRHF RSLKDGIVSQ IQVTRKAMGE KDPVAPGTTK  420
GETPRLRILD QTLRQQRAFQ QMNMMESHPW RPQRGLPERS VSVLRAWLFE HFLHPYPSDV  480
DKHILARQTG LSRSQVSNWF INARVRLWKP MVEEMYLEET KERENNMNNL TSSDGITKDP  540
GDSSRSGQNI RPEDQKPTPD QLVRIDSECL SSIITNPDKN HDSRSSKSTL LNHHMHPQQS  600
FGRVNESFGT MELDFSSYNH HQQHSGGTVS YANDHHHNPN QGFNGGGVSL TLGLQQHGGN  660
GVSLAFSPAS QSSLFYPRDH IEECQPVQYS LLDGEGQNTL PYRNLMGAQL LHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-15456514563Homeobox protein Meis2
3k2a_A2e-15456514563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238940.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-141BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM5WCS40.0M5WCS4_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46502030
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-142TALE family protein